ELISA Recombinant Rat Putative small membrane protein NID67(Nid67)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q99PE6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDAISQSPVDVLLPKHILDIWAIVLIILATVVIMTSLFLCPATAVIIYRMRTHPVLNGAV Protein Names:Recommended name: Putative small membrane protein NID67 Alternative name(s): NGF-induced differentiation clone 67 protein Gene Names:Name:Nid67 Expression Region:1-60 Sequence Info:fµLl length protein