Skip to Content

ELISA Recombinant Methanocaldococcus jannaschii UPF0333 protein MJ1400(MJ1400)

https://www.appliedbiolabs.com/web/image/product.template/143116/image_1920?unique=62ab6da
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) Uniprot NO.:Q58795 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKFIMKFIKSNKGQISLEFSLLVMVVVLSAIIVSYYLIKTAIETRNANMDVINQSSNVAE KSLSNVT Protein Names:Recommended name: UPF0333 protein MJ1400 Gene Names:Ordered Locus Names:MJ1400 Expression Region:1-67 Sequence Info:fµLl length protein

1,406.00 € 1406.0 EUR 1,406.00 €

1,406.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days