ELISA Recombinant Janthinobacterium sp. UPF0060 membrane protein mma_0129 (mma_0129)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis) Uniprot NO.:A6SU72 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFEIKTVALFVLTAIAEIVGCYLPYLWLRQGASIWLLVPAALALGIFVWLLSLHPEAAGR VYAAYGGAYVAVALAWLWVVDGIKPTNWDFVGVAVTLAGMGIILFAPRA Protein Names:Recommended name: UPF0060 membrane protein mma_0129 Gene Names:Ordered Locus Names:mma_0129 Expression Region:1-109 Sequence Info:fµLl length protein