ELISA Recombinant Odocoileus virginianus virginianus Medium-wave-sensitive opsin 1(OPN1MW)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Odocoileus virginianus virginianus (Virginia white-tailed deer) Uniprot NO.:O18911 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:APRWVYHLTSAWMVFVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAIADLVETIIAS TISVVNQMYGYFVLGHPLCVVEGYTASLCGITGLWSLAIISWERWMVVCRPFGNVRFDAK LAIAGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITC CFIPLSVIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAFCLCWGPYAFF ACFAAAHPGYAFHPLVAALPAYFAKSATIYNPI Protein Names:Recommended name: Medium-wave-sensitive opsin 1 Alternative name(s): Green cone photoreceptor pigment Green-sensitive opsin Gene Names:Name:OPN1MW Synonyms:GCP Expression Region:1-273 Sequence Info:fµLl length protein